PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G043900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 1115aa    MW: 124258 Da    PI: 6.3478
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G043900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.73.5e-21126226198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++p++ ae++       + +++  ++l  +d++ + W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  Manes.03G043900.1.p 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELGAKDLHDNAWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 213
                          99*****************************954.4444.48************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                          +  +++ +l+++v+ 
  Manes.03G043900.1.p 214 R--DEKSQLLLGVRH 226
                          4..466667888875 PP

2Auxin_resp126.41.8e-41252334183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aahaa+++s+F+++YnPras+seFv++++k++ka++++vsvGmRf+m+feteds  rr++Gt++g+sdldpvrW++S+Wr+L+
  Manes.03G043900.1.p 252 AAHAAANNSPFTIFYNPRASPSEFVIPFAKYSKAMYTQVSVGMRFRMMFETEDSGVRRYMGTITGISDLDPVRWKKSQWRNLQ 334
                          79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.67E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.0E-40118241IPR015300DNA-binding pseudobarrel domain
CDDcd100177.07E-18125218No hitNo description
SMARTSM010192.6E-19126228IPR003340B3 DNA binding domain
PfamPF023622.8E-19126226IPR003340B3 DNA binding domain
PROSITE profilePS5086311.491126228IPR003340B3 DNA binding domain
PfamPF065072.2E-36252334IPR010525Auxin response factor
PfamPF023099.4E-109841073IPR033389AUX/IAA domain
PROSITE profilePS5174526.7389871080IPR000270PB1 domain
SuperFamilySSF542779.81E-910031065No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1115 aa     Download sequence    Send to blast
MKVPPNGYMP NSAEGERKTI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
ADFVPSYPNL PSKLICMLHN VTLHADAETD EVYAQMTLQP VSKYDKEALL ASDMGLKQSR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELGAKD LHDNAWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKSQL LLGVRHANKQ QSALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPFA KYSKAMYTQV SVGMRFRMMF  300
ETEDSGVRRY MGTITGISDL DPVRWKKSQW RNLQVGWDES AAGERPSRVG IWEIEPVITP  360
FYICPPPFFR PKFPKQPGMP DDESDIENAF KRAMPWLGDD FGMKETPSSI FPGLSLVQWM  420
SMQQNNQFPA AQAGFFPPML PSNALHSTLG SDDPSKLLNF QAPGLSVPSL QFNKANPQNQ  480
VGQLPQPSMA WTQQQQLQQF LQTNISQQQP AQPQQLQQQP HPQQQQRQEP QQQQLSQQPQ  540
PEIQPRQIRQ QHPQLEQQQQ QQIFQPPVNS GVTANSISNQ NLQQPMVYSQ LQQQQQQQLL  600
ASNTQSQNIP PANKSSYQLS SLPQDATLQQ QMEQQSTLLQ RQQQQTQLQQ SPLQLLQQNL  660
SHRTQLPLPQ QQVQQLSQPS LSEQQLHLQL LQKMQQQQQQ QQQLLSPTSS PLQPQLLQQQ  720
LNHQQNQQFQ QSPVSQSQPQ GSNSFSTAAL GQSQSFPVCH SHVLQKPPTT NRAHSTLTDG  780
DAPSCSTSPS TNNCQISPSN FMNRNQESPA ILMGDQVVEP GTNLVQELNN KSDIRVKHEF  840
QSSKGLEQLK YKGTVPDQLE ACSSGTSYCL EAGNIQPNFS LLTYGLDGDI QSHPRNSMPF  900
AANIDSLAPD TLLSRGYDTQ KDIQNLVTNY GGTPRDIETE LSTAAISSQT FGVPNIPFKP  960
GCSNDVAIND SGVLNGGLWA NQTQRMRTYT KVQKRGSVGR SIDVTRYRGY DELRHDLARM  1020
FGIEGQLEDP QSSDWKLVYV DHENDILLVG DDPWEEFVSC VQSIKILSSA EVQQMSLDGD  1080
LGSVPVPNQA CSGTDSGNAW RGHYDDNSAA SFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1721535545388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324725.10.0auxin response factor 1 family protein
TrEMBLB9INC70.0B9INC7_POPTR; Auxin response factor
STRINGPOPTR_0018s07420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19